vialin stock

TB-500

5mg vial. Synthetic Thymosin Beta-4.

$75TB-500

// tl;dr

Studied for soft-tissue recovery and wound healing. A lab-made copy of a protein your body already produces.

// about

Synthetic Thymosin Beta-4, a 43-amino-acid peptide. Drives cellular migration via G-actin sequestration. Clinical research in wound healing (corneal, cardiac). Each vial contains 5mg lyophilized peptide.

// structure

drag to rotate
43 residues
// synthetic · 10 conformations
N-SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES-C
  • hydrophobic
  • polar
  • positive
  • negative
  • special

43 residues. Synthetic Thymosin Beta-4, the full-length sequence. The morph cycles through plausible low-frequency conformations - illustrative flexibility, not the experimentally resolved ensemble. Bead brightness scales with per-residue RMSF: the dimmer the residue, the more rigid it is in the ensemble.

// questions

// for research purposes only. not for human consumption.
// not intended to diagnose, treat, cure, or prevent any disease.