vialin stock

LL-37

5mg vial. Cathelicidin antimicrobial.

$125LL-37

// tl;dr

An antimicrobial peptide your own immune system makes. Studied for hard-to-treat infections, including biofilm-forming bacteria.

// about

Endogenous cathelicidin antimicrobial peptide. Direct pathogen membrane disruption plus broad immune signaling. Notably effective against biofilm-forming pathogens in research. 5mg lyophilized peptide.

// structure

drag to rotate
37 residues
// NMR · PDB 2K6O · 4 models
N-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-C
  • hydrophobic
  • polar
  • positive
  • negative
  • special

37 residues. The mature human cathelicidin antimicrobial peptide. The morph cycles through plausible low-frequency conformations - illustrative flexibility, not the experimentally resolved ensemble. Bead brightness scales with per-residue RMSF: the dimmer the residue, the more rigid it is in the ensemble.

// questions

// for research purposes only. not for human consumption.
// not intended to diagnose, treat, cure, or prevent any disease.